PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK00547.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 241aa    MW: 27658.1 Da    PI: 5.3954
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK00547.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1354.9e-42131412129
        NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                p+GfrF+Pt+ee++++yLk k +gk+  ++ v+++vd + +ePw+Lp k +++++++ w+fF++rd ky++++r+nr+tksgyWk tgk ++++s +g  
  PK00547.1  13 PVGFRFSPTEEEVINHYLKLKYQGKNDVVDPVMATVDFCAFEPWELPrKsMIESNDQVWWFFCPRDYKYNNSRRSNRTTKSGYWKITGKGQKIKSINGVI 112
                89************************999888**************96347778899******************************************* PP

        NAM 100 vglkktLvfykgrapkgektdWvmheyrle 129
                +g k++Lvf++ +   g+ t+Wvmhey+le
  PK00547.1 113 IGGKRILVFHR-SPCPGQGTEWVMHEYHLE 141
                **********5.666789**********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.58E-487160IPR003441NAC domain
PROSITE profilePS5100546.13512160IPR003441NAC domain
PfamPF023653.1E-2413140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MSCRAIVLPT NAPVGFRFSP TEEEVINHYL KLKYQGKNDV VDPVMATVDF CAFEPWELPR  60
KSMIESNDQV WWFFCPRDYK YNNSRRSNRT TKSGYWKITG KGQKIKSING VIIGGKRILV  120
FHRSPCPGQG TEWVMHEYHL EPENPKPNQK SYVVCRLERK TDEKALKTTS PDYETGQPSG  180
GNTPDDDSLL SWKFQFPSVN QLNLESLLLP QNSPNDDFGF LTGNQDSFGD VEDFMDLFDD  240
P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-301116314171Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010107113.17e-57NAC domain-containing protein 69
RefseqXP_010107114.12e-57NAC domain-containing protein 74
TrEMBLW9S3Y92e-57W9S3Y9_9R
TrEMBLW9SKD18e-57W9SKD1_9R
STRINGVIT_15s0048g02270.t017e-45(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20652586
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35580.15e-47NAC transcription factor-like 9